PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gorai.009G161800.2
Common NameB456_009G161800, LOC105771081
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family G2-like
Protein Properties Length: 383aa    MW: 43598.1 Da    PI: 9.5767
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gorai.009G161800.2genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like100.21.4e-3187140255
             G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                         prlrWtp+LH +Fv+ave+LGG+++AtPk +l+lm+vkgL+++h+kSHLQ+YR+
  Gorai.009G161800.2  87 PRLRWTPDLHLSFVHAVERLGGQDRATPKLVLQLMNVKGLSIAHIKSHLQMYRS 140
                         8****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129413.21383143IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.9E-2983141IPR009057Homeodomain-like
SuperFamilySSF466891.25E-1486141IPR009057Homeodomain-like
TIGRFAMsTIGR015571.5E-2287142IPR006447Myb domain, plants
PfamPF002499.4E-988139IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 383 aa     Download sequence    Send to blast
MMEMHGEEKR VNREVCSHKC TNFDLNEEAS CQDNDYVGKE GEVSVEEEEI EKRSTEEGSS  60
SNNNGGEGGG INDRRRTVRQ YVRSKLPRLR WTPDLHLSFV HAVERLGGQD RATPKLVLQL  120
MNVKGLSIAH IKSHLQMYRS KKLDESGQVL RKSNRSIKGR DEIRRMSLQR AAAVSSSPHR  180
RLRMENGGIV LAAESLENNF TLTRFRSPLY QRPLEFKPGF PRHHLEPNSL ISKAGVEKNG  240
FPKAGGLLSN EGQSNQIHGM EIRIGGMRRG WVLEEKRWQM ICNRWEIERE MSKHTFIGGH  300
YSTSSTQGSN TSTVGQFVSD NLSKFTSEFD APFLVELNQD KVMDREWLPD LQLRLSQRIG  360
IEDKKNTHCK GTHDINTRLS LS*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012447941.10.0PREDICTED: two-component response regulator ARR10-like
TrEMBLA0A0D2TKZ90.0A0A0D2TKZ9_G
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38300.13e-37G2-like family protein
Publications ? help Back to Top
  1. Paterson AH, et al.
    Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres.
    Nature, 2012. 492(7429): p. 423-7
    [PMID:23257886]